ARMC7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ARMC7 antibody is: synthetic peptide directed towards the N-terminal region of Human ARMC7. Synthetic peptide located within the following region: MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	armadillo repeat containing 7
Database Link	NP_078861 Entrez Gene 79637 Human UniProt ID Q9H6L4
Background	The function of this protein remains unknown.
Synonyms	FLJ22160
Note	Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Dog: 87%; Horse: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.