EFS (NM_032459) Human Recombinant Protein
CAT#: TP303800
Recombinant protein of human embryonal Fyn-associated substrate (EFS), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203800 protein sequence
Red=Cloning site Green=Tags(s) MAIATSVYVVPPPARPCPTSGPPAGPCPPSPDLIYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPY DCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLY EAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTLAQLLARSPPPPHRPRLPSAESLS RRPLPALPVPEAPSPSPVPSPAPGRKGSIQDRPLPPPPPRLPGYGGPKVEGDPEGREMEDDPAGHHNEYE GIPMAEEYDYVHLKGMDKAQGSRPPDQACTGDPELPERGMPAPQEALSPGEPLVVSTGDLQLLYFYAGQC QSHYSALQAAVAALMSSTQANQPPRLFVPHSKRVVVAAHRLVFVGDTLGRLAASAPLRAQVRAAGTALGQ ALRATVLAVKGAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115835 |
Locus ID | 10278 |
UniProt ID | O43281 |
Refseq Size | 2851 |
Cytogenetics | 14q11.2 |
Refseq ORF | 1404 |
Synonyms | CAS3; CASS3; EFS1; EFS2; HEFS; SIN |
Summary | The protein encoded by this gene is a member of the CAS (CRK-associated substrate) family of adaptor proteins which typically serve as scaffolds for the assembly of larger signaling complexes. These complexes form at the cell surface where integrin binding leads to the subsequent phosphorylation of a CAS protein. Additional binding of SRC family kinases leads to CAS hyperphosphorylation and the creation of binding sites for CRK and other proteins that cause actin cytoskeleton reorganization. This gene plays a role in integrin-mediated cell attachment, spreading, and migration and also plays a role in both normal and malignant cellular transformation. This broadly expressed gene has been shown to play a role in neurite outgrowth and its expression in the thymus and lymphocytes is important for T cell maturation and the development of immunological self-tolerance. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2020] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410095 | EFS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417016 | EFS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY410095 | Transient overexpression lysate of embryonal Fyn-associated substrate (EFS), transcript variant 2 |
CNY 3,080.00 |
|
LY417016 | Transient overexpression lysate of embryonal Fyn-associated substrate (EFS), transcript variant 1 |
CNY 4,840.00 |
|
PH303800 | EFS MS Standard C13 and N15-labeled recombinant protein (NP_115835) |
CNY 19,520.00 |