U1SNRNPBP (SNRNP35) (NM_180699) Human Recombinant Protein
CAT#: TP303746
Recombinant protein of human small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 3, 20 µg
View other "U1SNRNPBP" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203746 protein sequence
Red=Cloning site Green=Tags(s) MKPANMNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKED KLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGW IPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDR GREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_851030 |
Locus ID | 11066 |
UniProt ID | Q16560 |
Refseq Size | 1070 |
Cytogenetics | 12q24.31 |
Refseq ORF | 753 |
Synonyms | HM-1; U1SNRNPBP |
Summary | The protein encoded by this gene is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. Alternative splicing results in multiple transcript variants encoding two distinct isoforms and representing a non-protein coding variant. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405831 | SNRNP35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405832 | SNRNP35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405831 | Transient overexpression lysate of small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 3 |
CNY 3,080.00 |
|
LY405832 | Transient overexpression lysate of small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 4 |
CNY 3,080.00 |
|
PH303746 | SNRNP35 MS Standard C13 and N15-labeled recombinant protein (NP_851030) |
CNY 19,520.00 |
其它U1SNRNPBP产品