U1SNRNPBP (SNRNP35) (NM_180699) Human Mass Spec Standard
CAT#: PH303746
SNRNP35 MS Standard C13 and N15-labeled recombinant protein (NP_851030)
View other "U1SNRNPBP" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNRNP35 MS Standard C13 and N15-labeled recombinant protein (NP_851030) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203746 |
Predicted MW | 30 kDa |
Protein Sequence |
>RC203746 protein sequence
Red=Cloning site Green=Tags(s) MKPANMNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKED KLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGW IPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDR GREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_851030 |
RefSeq Size | 1070 |
RefSeq ORF | 753 |
Synonyms | HM-1; U1SNRNPBP |
Locus ID | 11066 |
Cytogenetics | 12q24.31 |
Summary | The protein encoded by this gene is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. Alternative splicing results in multiple transcript variants encoding two distinct isoforms and representing a non-protein coding variant. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405831 | SNRNP35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405832 | SNRNP35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405831 | Transient overexpression lysate of small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 3 |
CNY 3,080.00 |
|
LY405832 | Transient overexpression lysate of small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 4 |
CNY 3,080.00 |
|
TP303746 | Recombinant protein of human small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它U1SNRNPBP产品