OTUD6B (NM_016023) Human Recombinant Protein
CAT#: TP303722
Recombinant protein of human OTU domain containing 6B (OTUD6B), 20 µg
View other "OTUD6B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203722 protein sequence
Red=Cloning site Green=Tags(s) MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQL KLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQ ILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPE EFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNS VTRLVNIVTENCS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057107 |
Locus ID | 51633 |
UniProt ID | Q8N6M0, A0A087X0W9 |
Refseq Size | 3306 |
Cytogenetics | 8q21.3 |
Refseq ORF | 879 |
Synonyms | CGI-77; DUBA-5; DUBA5; IDDFSDA |
Summary | This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquitinating enzymes. Deubiquitinating enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a negative regulator of the cell cycle in B cells. [provided by RefSeq, Nov 2013] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414242 | OTUD6B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414242 | Transient overexpression lysate of OTU domain containing 6B (OTUD6B) |
CNY 3,080.00 |
|
PH303722 | OTUD6B MS Standard C13 and N15-labeled recombinant protein (NP_057107) |
CNY 19,520.00 |