Cofilin 1 (CFL1) (NM_005507) Human Recombinant Protein
CAT#: TP303585
Recombinant protein of human cofilin 1 (non-muscle) (CFL1), 20 µg
View other "Cofilin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203585 protein sequence
Red=Cloning site Green=Tags(s) MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY EEVKDRCTLAEKLGGSAVISLEGKPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005498 |
Locus ID | 1072 |
UniProt ID | P23528 |
Refseq Size | 1260 |
Cytogenetics | 11q13.1 |
Refseq ORF | 498 |
Synonyms | CFL; cofilin; HEL-S-15 |
Summary | The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
S-nitrosylation of Cofilin-1 Serves as a Novel Pathway for VEGF-Stimulated Endothelial Cell Migration.
,null,
Journal of cellular physiology
,PubMed ID 25056928
[CFL1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401686 | CFL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401686 | Transient overexpression lysate of cofilin 1 (non-muscle) (CFL1) |
CNY 3,080.00 |
|
PH303585 | CFL1 MS Standard C13 and N15-labeled recombinant protein (NP_005498) |
CNY 19,520.00 |
其它Cofilin 1产品