COPE (NM_007263) Human Recombinant Protein
CAT#: TP303531
Recombinant protein of human coatomer protein complex, subunit epsilon (COPE), transcript variant 1, 20 µg
View other "COPE" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203531 protein sequence
Red=Cloning site Green=Tags(s) MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA HRSHPFIKEYQAKENDFDRLVLQYAPSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009194 |
Locus ID | 11316 |
UniProt ID | O14579 |
Refseq Size | 1134 |
Cytogenetics | 19p13.11 |
Refseq ORF | 924 |
Synonyms | epsilon-COP |
Summary | The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404568 | COPE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416083 | COPE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404568 | Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 3 |
CNY 3,080.00 |
|
LY416083 | Transient overexpression lysate of coatomer protein complex, subunit epsilon (COPE), transcript variant 1 |
CNY 3,080.00 |
|
PH303531 | COPE MS Standard C13 and N15-labeled recombinant protein (NP_009194) |
CNY 19,520.00 |