CDC34 (NM_004359) Human Recombinant Protein
CAT#: TP303517
Recombinant protein of human cell division cycle 34 homolog (S. cerevisiae) (CDC34), 20 µg
View other "CDC34" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203517 representing NM_004359
Red=Cloning site Green=Tags(s) MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY YEDGEVEEEADSCFGDDEDDSGTEES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004350 |
Locus ID | 997 |
UniProt ID | P49427, A0A024R1Z1 |
Refseq Size | 1462 |
Cytogenetics | 19p13.3 |
Refseq ORF | 708 |
Synonyms | E2-CDC34; UBC3; UBCH3; UBE2R1 |
Summary | The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418044 | CDC34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418044 | Transient overexpression lysate of cell division cycle 34 homolog (S. cerevisiae) (CDC34) |
CNY 3,080.00 |
|
PH303517 | CDC34 MS Standard C13 and N15-labeled recombinant protein (NP_004350) |
CNY 19,520.00 |