United States
Germany
Japan
United Kingdom
China
FHL1 (NM_001449) Human Recombinant Protein
CAT＃: TP303478
Recombinant protein of human four and a half LIM domains 1 (FHL1), 20 µg
View other "FHL1" proteins (17)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203478 representing NM_001449
Red=Cloning site Green=Tags(s) MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.7 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme substrate (PMID: 26551678) |
| Reference Data | |
| RefSeq | NP_001440 |
| Locus ID | 2273 |
| UniProt ID | Q13642 |
| Refseq Size | 2398 |
| Cytogenetics | Xq26.3 |
| Refseq ORF | 840 |
| Synonyms | FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA |
| Summary | This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.[provided by RefSeq, Nov 2009] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Development of autoantibodies against muscle-specific FHL1 in severe inflammatory myopathies
,Albrecht, I;Wick, C;Hallgren, Å;Tjärnlund, A;Nagaraju, K;Andrade, F;Thompson, K;Coley, W;Phadke, A;Diaz-Gallo, LM;Bottai, M;Nennesmo, I;Chemin, K;Herrath, J;Johansson, K;Wikberg, A;Ytterberg, AJ;Zubarev, RA;Danielsson, O;Krystufkova, O;Vencovsky, J;Landegren, N;Wahren-Herlenius, M;Padyukov, L;Kämpe, O;Lundberg, IE;,
J. Clin. Invest.
,PubMed ID 26551678
[FHL1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400563 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431153 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431271 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431283 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431827 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431828 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400563 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 |
CNY 3,080.00 |
|
| LY431153 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 |
CNY 3,080.00 |
|
| LY431271 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 |
CNY 3,080.00 |
|
| LY431283 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 |
CNY 3,080.00 |
|
| LY431827 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 |
CNY 3,080.00 |
|
| LY431828 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 |
CNY 3,080.00 |
|
| PH303478 | FHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001440) |
CNY 19,520.00 |
|
| TP328125 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP328243 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP328799 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP328800 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4, 20 µg |
CNY 2,900.00 |
