PICK1 (NM_001039584) Human Recombinant Protein
CAT#: TP303455
Purified recombinant protein of Homo sapiens protein interacting with PRKCA 1 (PICK1), transcript variant 3, 20 µg
View other "PICK1" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203455 protein sequence
Red=Cloning site Green=Tags(s) MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034673 |
Locus ID | 9463 |
UniProt ID | Q9NRD5 |
Refseq Size | 2073 |
Cytogenetics | 22q13.1 |
Refseq ORF | 1245 |
Synonyms | PICK; PRKCABP |
Summary | The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415785 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422082 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422083 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425646 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415785 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 1 |
CNY 3,080.00 |
|
LY422082 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 2 |
CNY 3,080.00 |
|
LY422083 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 3 |
CNY 3,080.00 |
|
LY425646 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 3 |
CNY 3,080.00 |
|
PH303455 | PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034673) |
CNY 14,250.00 |
|
PH322869 | PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_036539) |
CNY 19,520.00 |
|
PH322916 | PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034672) |
CNY 19,520.00 |
|
TP322869 | Recombinant protein of human protein interacting with PRKCA 1 (PICK1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP322916 | Recombinant protein of human protein interacting with PRKCA 1 (PICK1), transcript variant 2, 20 µg |
CNY 2,900.00 |