PUF60 (NM_014281) Human Recombinant Protein
CAT#: TP303454
Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 2, 20 µg
View other "PUF60" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203454 protein sequence
Red=Cloning site Green=Tags(s) MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKS IDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNR IYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYL RVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTL PQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ EHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEE DAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055096 |
Locus ID | 22827 |
UniProt ID | Q9UHX1 |
Refseq Size | 1897 |
Cytogenetics | 8q24.3 |
Refseq ORF | 1626 |
Synonyms | FIR; RoBPI; SIAHBP1; VRJS |
Summary | This gene encodes a nucleic acid-binding protein that plays a role in a variety of nuclear processes, including pre-mRNA splicing and transcriptional regulation. The encoded protein forms a complex with the far upstream DNA element (FUSE) and FUSE-binding protein at the myelocytomatosis oncogene (MYC) promoter. This complex represses MYC transcription through the core-TFIIH basal transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012] |
Protein Pathways | Spliceosome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The prevalence and clinical significance of anti-PUF60 antibodies in patients with idiopathic inflammatory myopathy.
,null,
Clinical rheumatology
,PubMed ID 29541951
[PUF60]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409189 | PUF60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC415385 | PUF60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409189 | Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 1 |
CNY 4,840.00 |
|
LY415385 | Transient overexpression lysate of poly-U binding splicing factor 60KDa (PUF60), transcript variant 2 |
CNY 3,080.00 |
|
PH303454 | PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_055096) |
CNY 19,520.00 |
|
PH323492 | PUF60 MS Standard C13 and N15-labeled recombinant protein (NP_510965) |
CNY 19,520.00 |
|
TP323492 | Recombinant protein of human poly-U binding splicing factor 60KDa (PUF60), transcript variant 1, 20 µg |
CNY 2,900.00 |