MID1IP1 (NM_021242) Human Recombinant Protein
CAT#: TP303444
Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1, 20 µg
View other "MID1IP1" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203444 protein sequence
Red=Cloning site Green=Tags(s) MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067065 |
Locus ID | 58526 |
UniProt ID | Q9NPA3 |
Refseq Size | 3795 |
Cytogenetics | Xp11.4 |
Refseq ORF | 549 |
Synonyms | G12-like; MIG12; S14R; STRAIT11499; THRSPL |
Summary | Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400445 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411994 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420677 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429650 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400445 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 |
CNY 3,080.00 |
|
LY411994 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 |
CNY 3,080.00 |
|
LY420677 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 |
CNY 3,080.00 |
|
PH303444 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065) |
CNY 19,520.00 |
|
PH317566 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260) |
CNY 19,520.00 |
|
PH321845 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) |
CNY 19,520.00 |
|
TP317566 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP321845 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它MID1IP1产品