p38 (CRK) (NM_005206) Human Recombinant Protein
CAT#: TP303438
Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203438 protein sequence
Red=Cloning site Green=Tags(s) MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005197 |
Locus ID | 1398 |
UniProt ID | P46108, A0A0S2Z3K9 |
Refseq Size | 3055 |
Cytogenetics | 17p13.3 |
Refseq ORF | 612 |
Synonyms | CRKII; p38 |
Summary | This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402580 | CRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417443 | CRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402580 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II |
CNY 3,080.00 |
|
LY417443 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I |
CNY 3,080.00 |
|
PH301701 | CRK MS Standard C13 and N15-labeled recombinant protein (NP_058431) |
CNY 19,520.00 |
|
PH303438 | CRK MS Standard C13 and N15-labeled recombinant protein (NP_005197) |
CNY 19,520.00 |
|
TP301701 | Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II, 20 µg |
CNY 2,900.00 |