Peroxiredoxin 4 (PRDX4) (NM_006406) Human Recombinant Protein
CAT#: TP303330
Recombinant protein of human peroxiredoxin 4 (PRDX4), 20 µg
View other "Peroxiredoxin 4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203330 protein sequence
Red=Cloning site Green=Tags(s) MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006397 |
Locus ID | 10549 |
UniProt ID | Q13162 |
Refseq Size | 921 |
Cytogenetics | Xp22.11 |
Refseq ORF | 813 |
Synonyms | AOE37-2; AOE372; HEL-S-97n; PRX-4 |
Summary | The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401927 | PRDX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401927 | Transient overexpression lysate of peroxiredoxin 4 (PRDX4) |
CNY 3,080.00 |
|
PH303330 | PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397) |
CNY 19,520.00 |
|
TP720568 | Recombinant protein of human peroxiredoxin 4 (PRDX4) |
CNY 3,140.00 |
|
TP750204 | Purified recombinant protein of Human peroxiredoxin 4 (PRDX4), full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Peroxiredoxin 4产品