Peroxiredoxin 4 (PRDX4) (NM_006406) Human Mass Spec Standard
CAT#: PH303330
PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397)
View other "Peroxiredoxin 4" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203330 |
Predicted MW | 30.5 kDa |
Protein Sequence |
>RC203330 protein sequence
Red=Cloning site Green=Tags(s) MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006397 |
RefSeq Size | 921 |
RefSeq ORF | 813 |
Synonyms | AOE37-2; AOE372; HEL-S-97n; PRX-4 |
Locus ID | 10549 |
Cytogenetics | Xp22.11 |
Summary | The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401927 | PRDX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401927 | Transient overexpression lysate of peroxiredoxin 4 (PRDX4) |
CNY 3,080.00 |
|
TP303330 | Recombinant protein of human peroxiredoxin 4 (PRDX4), 20 µg |
CNY 2,900.00 |
|
TP720568 | Recombinant protein of human peroxiredoxin 4 (PRDX4) |
CNY 3,140.00 |
|
TP750204 | Purified recombinant protein of Human peroxiredoxin 4 (PRDX4), full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Peroxiredoxin 4产品