TGN46 (TGOLN2) (NM_006464) Human Recombinant Protein
CAT#: TP303323
Recombinant protein of human trans-golgi network protein 2 (TGOLN2), 20 µg
View other "TGN46" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203323 protein sequence
Red=Cloning site Green=Tags(s) MRFVVALVLLNVAAAGAVPLLATESVKQEDAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKS SAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKS GAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKS GAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADT NQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSA SSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK VTRRPKASDYQRLDQKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006455 |
Locus ID | 10618 |
UniProt ID | O43493 |
Refseq Size | 6373 |
Cytogenetics | 2p11.2 |
Refseq ORF | 1311 |
Synonyms | hTGN46; hTGN48; hTGN51; TGN38; TGN46; TGN48; TGN51; TTGN2 |
Summary | This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401942 | TGOLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401942 | Transient overexpression lysate of trans-golgi network protein 2 (TGOLN2) |
CNY 3,080.00 |
|
PH303323 | TGOLN2 MS Standard C13 and N15-labeled recombinant protein (NP_006455) |
CNY 19,520.00 |