BZW2 (NM_014038) Human Recombinant Protein
CAT#: TP303310
Recombinant protein of human basic leucine zipper and W2 domains 2 (BZW2), 20 µg
View other "BZW2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203310 protein sequence
Red=Cloning site Green=Tags(s) MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFD ILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFL KAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKA NLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVK EEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYC YDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054757 |
Locus ID | 28969 |
UniProt ID | Q9Y6E2 |
Refseq Size | 1867 |
Cytogenetics | 7p21.1 |
Refseq ORF | 1257 |
Synonyms | HSPC028; MST017; MSTP017 |
Summary | May be involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415513 | BZW2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC431914 | BZW2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415513 | Transient overexpression lysate of basic leucine zipper and W2 domains 2 (BZW2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY431914 | Transient overexpression lysate of basic leucine zipper and W2 domains 2 (BZW2), transcript variant 1 |
CN¥ 3,080.00 |
|
PH303310 | BZW2 MS Standard C13 and N15-labeled recombinant protein (NP_054757) |
CN¥ 19,520.00 |
|
TP328886 | Recombinant protein of human basic leucine zipper and W2 domains 2 (BZW2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |