SIAH Interacting Protein (CACYBP) (NM_014412) Human Recombinant Protein
CAT#: TP303302
Recombinant protein of human calcyclin binding protein (CACYBP), transcript variant 1, 20 µg
View other "SIAH Interacting Protein" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203302 protein sequence
Red=Cloning site Green=Tags(s) MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI NKAWVESREKQAKGDTEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055227 |
Locus ID | 27101 |
UniProt ID | Q9HB71 |
Refseq Size | 3060 |
Cytogenetics | 1q25.1 |
Refseq ORF | 684 |
Synonyms | GIG5; PNAS-107; S100A6BP; SIP |
Summary | The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415305 | CACYBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423448 | CACYBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415305 | Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 1 |
CNY 3,080.00 |
|
LY423448 | Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 2 |
CNY 3,080.00 |
|
PH303302 | CACYBP MS Standard C13 and N15-labeled recombinant protein (NP_055227) |
CNY 19,520.00 |
|
PH309815 | CACYBP MS Standard C13 and N15-labeled recombinant protein (NP_001007215) |
CNY 19,520.00 |
|
TP309815 | Recombinant protein of human calcyclin binding protein (CACYBP), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它SIAH Interacting Protein产品