Ferritin Light Chain (FTL) (NM_000146) Human Recombinant Protein
CAT#: TP303296
Recombinant protein of human ferritin, light polypeptide (FTL), 20 µg
View other "Ferritin Light Chain" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203296 protein sequence
Red=Cloning site Green=Tags(s) MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000137 |
Locus ID | 2512 |
UniProt ID | P02792 |
Refseq Size | 889 |
Cytogenetics | 19q13.33 |
Refseq ORF | 525 |
Synonyms | LFTD; NBIA3 |
Summary | This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400051 | FTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400051 | Transient overexpression lysate of ferritin, light polypeptide (FTL) |
CNY 3,080.00 |
|
PH303296 | FTL MS Standard C13 and N15-labeled recombinant protein (NP_000137) |
CNY 19,520.00 |
|
TP721181 | Purified recombinant protein of Human ferritin, light polypeptide (FTL) |
CNY 3,140.00 |
其它Ferritin Light Chain产品