Ferritin Light Chain (FTL) (NM_000146) Human Recombinant Protein

CAT#: TP303296

Recombinant protein of human ferritin, light polypeptide (FTL), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "Ferritin Light Chain" proteins (4)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00

CN¥ 6,650.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00


FTL rabbit polyclonal antibody
    • 25 ul

CN¥ 800.00
CN¥ 1,280.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CN¥ 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203296 protein sequence
Red=Cloning site Green=Tags(s)

MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ
NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK
LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000137
Locus ID 2512
UniProt ID P02792
Refseq Size 889
Cytogenetics 19q13.33
Refseq ORF 525
Synonyms LFTD; NBIA3
Summary This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...