DAP13 (NDUFA12) (NM_018838) Human Recombinant Protein
CAT#: TP303265
Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12), 20 µg
View other "DAP13" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203265 protein sequence
Red=Cloning site Green=Tags(s) MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNG KNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPP STPYK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061326 |
Locus ID | 55967 |
UniProt ID | Q9UI09 |
Refseq Size | 592 |
Cytogenetics | 12q22 |
Refseq ORF | 435 |
Synonyms | B17.2; DAP13; MC1DN23 |
Summary | This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412878 | NDUFA12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412878 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12) |
CNY 3,080.00 |
|
PH303265 | NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326) |
CNY 19,520.00 |