Calreticulin (CALR) (NM_004343) Human Recombinant Protein
CAT#: TP303222
Recombinant protein of human calreticulin (CALR), 20 µg
View other "Calreticulin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 4 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203222 protein sequence
Red=Cloning site Green=Tags(s) MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQ DARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPG TKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKD PDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQI DNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT KAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004334 |
Locus ID | 811 |
UniProt ID | P27797 |
Refseq Size | 1929 |
Cytogenetics | 19p13.13 |
Refseq ORF | 1251 |
Synonyms | cC1qR; CRT; HEL-S-99n; RO; SSA |
Summary | Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type.[provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, Secreted Protein, Transcription Factors |
Protein Pathways | Antigen processing and presentation |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
A novel autoantibody targeting calreticulin is associated with cancer in patients with idiopathic inflammatory myopathies
,Chen, H;Yang, H;Cheng, QX;Ge, YP;Peng, QL;Zhang, YM;Cheng, GH;Wang, GC;Lu, X;,
Clin Transl Immunology
,PubMed ID 33082955
[CALR]
|
Calnexin/Calreticulin and Assays Related to N-Glycoprotein Folding In Vitro
,Ihara, Y;Ikezaki, M;Takatani, M;Ito, Y;,
Methods Mol. Biol.
,PubMed ID 32306337
[CALR]
|
Increasing intratumor C/EBP-β LIP and nitric oxide levels overcome resistance to doxorubicin in triple negative breast cancer
,null,
Journal of Experimental & Clinical Cancer Research : CR
,PubMed ID 30482226
[CALR]
|
An unexpected protein interaction promotes drug resistance in leukemia
,null,
Nature Communications
,PubMed ID 29146910
[CALR]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它Calreticulin产品