SQSTM1 (NM_003900) Human Recombinant Protein
CAT#: TP303214
Recombinant protein of human sequestosome 1 (SQSTM1), transcript variant 1, 20 µg
View other "SQSTM1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203214 protein sequence
Red=Cloning site Green=Tags(s) MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDE DGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRY KCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRP PRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEE KSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPST GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK NYDIGAALDTIQYSKHPPPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003891 |
Locus ID | 8878 |
UniProt ID | Q13501 |
Refseq Size | 2923 |
Cytogenetics | 5q35.3 |
Refseq ORF | 1320 |
Synonyms | A170; DMRV; FTDALS3; NADGP; OSIL; p60; p62; p62B; PDB3; ZIP3 |
Summary | This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401285 | SQSTM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428020 | SQSTM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401285 | Transient overexpression lysate of sequestosome 1 (SQSTM1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428020 | Transient overexpression lysate of sequestosome 1 (SQSTM1), transcript variant 2 |
CN¥ 3,080.00 |
|
PH303214 | SQSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_003891) |
CN¥ 19,520.00 |