United States
Germany
Japan
United Kingdom
China
EEF1D (NM_001960) Human Recombinant Protein
CAT＃: TP303202
Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2, 20 µg
View other "EEF1D" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203202 protein sequence
Red=Cloning site Green=Tags(s) MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGS RRDPRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPP ALAPWGLCTHGNQVACHHVTWGIWVNKSSFDQAERAFVEWSQALLLAPEGSRRQGTPNTGQQVAVPDLAH QPSPPVNGQPPLGSLQALVREVWLEKPRYDAAERGFYEALFDGHPPGKVRLQERAGLAEGARRGRRDRRG RNILGNKRAGLRRADGEAPSALPYCYFLQKDAEAPWLSKPAYDSAECRHHAAEALRVAWCLEAASLSHRP GPRSGLSVSSLRPNRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARAR ENIQKSLAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRA TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVA KSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEIT KFEEHVQSVDIAAFNKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Biolayer interferometry (BLI) assay (PMID: 26624286) |
| Reference Data | |
| RefSeq | NP_001951 |
| Locus ID | 1936 |
| UniProt ID | P29692 |
| Refseq Size | 1276 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 1944 |
| Synonyms | EF-1D; EF1D; FP1047 |
| Summary | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.[provided by RefSeq, Aug 2010] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target
,Li, D;Wei, T;Rawle, DJ;Qin, F;Wang, R;Soares, DC;Jin, H;Sivakumaran, H;Lin, MH;Spann, K;Abbott, CM;Harrich, D;,
PLoS Pathog.
,PubMed ID 26624286
[EEF1D]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410171 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC419621 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427131 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427133 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427135 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410171 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 |
CNY 4,840.00 |
|
| LY419621 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2 |
CNY 3,080.00 |
|
| LY427131 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 3 |
CNY 3,080.00 |
|
| LY427133 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5 |
CNY 3,080.00 |
|
| LY427135 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 6 |
CNY 3,080.00 |
|
| PH303202 | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001951) |
CNY 19,520.00 |
|
| PH325386 | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001123527) |
CNY 19,520.00 |
|
| TP325386 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP760795 | Purified recombinant protein of Human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
