PDE6D (NM_002601) Human Recombinant Protein
CAT#: TP303172
Recombinant protein of human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), 20 µg
View other "PDE6D" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203172 protein sequence
Red=Cloning site Green=Tags(s) MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV STSRVRLFYV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002592 |
Locus ID | 5147 |
UniProt ID | O43924 |
Refseq Size | 1214 |
Cytogenetics | 2q37.1 |
Refseq ORF | 450 |
Synonyms | JBTS22; PDED |
Summary | This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014] |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Identification of PDE6D as a molecular target of anecortave acetate via a methotrexate-anchored yeast three-hybrid screen.
,null,
ACS chemical biology
,PubMed ID 23301619
[PDE6D]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419219 | PDE6D HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419219 | Transient overexpression lysate of phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D) |
CN¥ 3,080.00 |
|
PH303172 | PDE6D MS Standard C13 and N15-labeled recombinant protein (NP_002592) |
CN¥ 19,520.00 |
|
TP760649 | Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |
|
TP761964 | Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CN¥ 2,050.00 |