GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein
CAT#: TP303135
Recombinant protein of human prolactin-induced protein (PIP), 20 µg
View other "GCDFP 15" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 2 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203135 protein sequence
Red=Cloning site Green=Tags(s) MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI EILKVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 27837018) |
Reference Data | |
RefSeq | NP_002643 |
Locus ID | 5304 |
UniProt ID | P12273 |
Refseq Size | 591 |
Cytogenetics | 7q34 |
Refseq ORF | 438 |
Synonyms | GCDFP-15; GCDFP15; GPIP4 |
Protein Families | Secreted Protein |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Bone Microenvironment Changes in Latexin Expression Promote Chemoresistance
,null,
Molecular cancer research : MCR
,PubMed ID 28087740
[PIP]
|
Role of dendritic cell maturation factors produced by human invariant NKT cells in immune tolerance
,Lee, HW;Jie, HB;Bollyky, PL;Sarracino, D;Kim, TS;Wilson, BS;,
J. Leukoc. Biol.
,PubMed ID 27837018
[PIP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419186 | PIP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419186 | Transient overexpression lysate of prolactin-induced protein (PIP) |
CN¥ 3,080.00 |
|
PH303135 | PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) |
CN¥ 19,520.00 |
|
TP701042 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with C-terminal His tag, expressed in HEK293 cells, 50ug |
CN¥ 7,820.00 |
|
TP710252 | Purified recombinant protein of Human prolactin-induced protein (PIP), residues aa29–end, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
CN¥ 4,020.00 |
|
TP762416 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |
其它GCDFP 15产品