LYRM2 (NM_020466) Human Recombinant Protein
CAT#: TP303091
Recombinant protein of human LYR motif containing 2 (LYRM2), 20 µg
View other "LYRM2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203091 protein sequence
Red=Cloning site Green=Tags(s) MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMIT QGNMQLKELEKTLALAKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065199 |
Locus ID | 57226 |
UniProt ID | Q9NU23 |
Refseq Size | 5371 |
Cytogenetics | 6q15 |
Refseq ORF | 264 |
Synonyms | DJ122O8.2 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412437 | LYRM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412437 | Transient overexpression lysate of LYR motif containing 2 (LYRM2), transcript variant 1 |
CNY 3,080.00 |
|
PH303091 | LYRM2 MS Standard C13 and N15-labeled recombinant protein (NP_065199) |
CNY 19,520.00 |