Secretogranin 3 (SCG3) (NM_013243) Human Recombinant Protein
CAT#: TP303080
Recombinant protein of human secretogranin III (SCG3), 20 µg
View other "Secretogranin 3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203080 protein sequence
Red=Cloning site Green=Tags(s) MGFLGTGTWILVLVLPIQAFPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYS FVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQ LDGTPLTAEDIVHKIAARIYEENDRAAFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEE DPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNF YALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDN ISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLK KHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037375 |
Locus ID | 29106 |
UniProt ID | Q8WXD2 |
Refseq Size | 3366 |
Cytogenetics | 15q21.2 |
Refseq ORF | 1404 |
Synonyms | SGIII |
Summary | The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402232 | SCG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402232 | Transient overexpression lysate of secretogranin III (SCG3), transcript variant 1 |
CNY 3,080.00 |
|
PH303080 | SCG3 MS Standard C13 and N15-labeled recombinant protein (NP_037375) |
CNY 19,520.00 |
其它Secretogranin 3产品