CHCHD6 (NM_032343) Human Recombinant Protein
CAT#: TP302975
Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6), 20 µg
View other "CHCHD6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202975 protein sequence
Red=Cloning site Green=Tags(s) MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLP RSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARE LESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRD RPHEVLLCSDLVKAYQRCVSAAHKG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115719 |
Locus ID | 84303 |
UniProt ID | Q9BRQ6 |
Refseq Size | 1020 |
Cytogenetics | 3q21.3 |
Refseq ORF | 705 |
Synonyms | CHCM1; Mic25; MICOS25; PPP1R23 |
Summary | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A CHCHD6–APP axis connects amyloid and mitochondrial pathology in Alzheimer’s disease
,null,
Acta Neuropathologica
,PubMed ID 36104602
[CHCHD6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410180 | CHCHD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410180 | Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 6 (CHCHD6) |
CNY 3,080.00 |
|
PH302975 | CHCHD6 MS Standard C13 and N15-labeled recombinant protein (NP_115719) |
CNY 19,520.00 |