Neuropilin 1 (NRP1) (NM_001024629) Human Recombinant Protein
CAT#: TP302952
Recombinant protein of human neuropilin 1 (NRP1), transcript variant 3, 20 µg
View other "Neuropilin 1" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202952 protein sequence
Red=Cloning site Green=Tags(s) MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMIN FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEI FKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDR LEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALG MESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETK KKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLG EEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTR FIRIYPERATHGGLGLRMELLGCEVEGGTTVLATEKPTVIDSTIQSGIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001019800 |
Locus ID | 8829 |
UniProt ID | O14786, Q68DN3 |
Refseq Size | 2373 |
Cytogenetics | 10p11.22 |
Refseq ORF | 1827 |
Synonyms | BDCA4; CD304; NP1; NRP; VEGF165R |
Summary | This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells. [provided by RefSeq, Nov 2020] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401276 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422521 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422522 | NRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401276 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 1 |
CNY 4,840.00 |
|
LY422521 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 2 |
CNY 3,080.00 |
|
LY422522 | Transient overexpression lysate of neuropilin 1 (NRP1), transcript variant 3 |
CNY 3,080.00 |
|
PH302952 | NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019800) |
CNY 19,520.00 |
|
PH303508 | NRP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019799) |
CNY 19,520.00 |
|
TP303508 | Recombinant protein of human neuropilin 1 (NRP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Neuropilin 1产品