NRIP3 (NM_020645) Human Recombinant Protein
CAT#: TP302937
Recombinant protein of human nuclear receptor interacting protein 3 (NRIP3), 20 µg
View other "NRIP3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202937 protein sequence
Red=Cloning site Green=Tags(s) MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQPHNILQRRLME TNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKALVDTGCLYNLISLACVDRL GLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQTLRSLKCIINL DKHRLIMGKTDKEEIPFVETVSLNEDNTSEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065696 |
Locus ID | 56675 |
UniProt ID | Q9NQ35 |
Refseq Size | 3809 |
Cytogenetics | 11p15.4 |
Refseq ORF | 723 |
Synonyms | C11orf14; NY-SAR-105 |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412407 | NRIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412407 | Transient overexpression lysate of nuclear receptor interacting protein 3 (NRIP3) |
CNY 3,080.00 |
|
PH302937 | NRIP3 MS Standard C13 and N15-labeled recombinant protein (NP_065696) |
CNY 19,520.00 |