PEX14 (NM_004565) Human Recombinant Protein
CAT#: TP302903
Recombinant protein of human peroxisomal biogenesis factor 14 (PEX14), 20 µg
View other "PEX14" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202903 protein sequence
Red=Cloning site Green=Tags(s) MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQS GTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGRE DRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNIN ELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEG HSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDR RGGDGQINEQVEKLRRPEGASNESERD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004556 |
Locus ID | 5195 |
UniProt ID | O75381 |
Refseq Size | 1945 |
Cytogenetics | 1p36.22 |
Refseq ORF | 1131 |
Synonyms | dJ734G22.2; NAPP2; PBD13A; Pex14p |
Summary | This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417901 | PEX14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417901 | Transient overexpression lysate of peroxisomal biogenesis factor 14 (PEX14) |
CNY 3,080.00 |
|
PH302903 | PEX14 MS Standard C13 and N15-labeled recombinant protein (NP_004556) |
CNY 19,520.00 |