PARP16 (NM_017851) Human Recombinant Protein
CAT#: TP302846
Recombinant protein of human poly (ADP-ribose) polymerase family, member 16 (PARP16), 20 µg
View other "PARP16" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202846 protein sequence
Red=Cloning site Green=Tags(s) MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKE LLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYE TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS CVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRA SSQLSWFSSHWFTVMISLYLLLLLIVSVINSSAFQHFWNRAKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060321 |
Locus ID | 54956 |
UniProt ID | Q8N5Y8 |
Refseq Size | 2551 |
Cytogenetics | 15q22.31 |
Refseq ORF | 969 |
Synonyms | ARTD15; C15orf30; pART15 |
Summary | Intracellular mono-ADP-ribosyltransferase that may play a role in different processes through the mono-ADP-ribosylation of proteins involved in those processes (PubMed:23103912, PubMed:22701565, PubMed:25043379). May play a role in the unfolded protein response (UPR), by ADP-ribosylating and activating EIF2AK3 and ERN1, two important UPR effectors (PubMed:23103912). May also mediate mono-ADP-ribosylation of karyopherin KPNB1 a nuclear import factor (PubMed:22701565). May not modify proteins on arginine or cysteine residues compared to other mono-ADP-ribosyltransferases (PubMed:22701565).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402632 | PARP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402632 | Transient overexpression lysate of poly (ADP-ribose) polymerase family, member 16 (PARP16) |
CNY 3,080.00 |
|
PH302846 | PARP16 MS Standard C13 and N15-labeled recombinant protein (NP_060321) |
CNY 19,520.00 |