NFYB (NM_006166) Human Recombinant Protein
CAT#: TP302749
Recombinant protein of human nuclear transcription factor Y, beta (NFYB), 20 µg
View other "NFYB" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202749 protein sequence
Red=Cloning site Green=Tags(s) MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006157 |
Locus ID | 4801 |
UniProt ID | P25208 |
Refseq Size | 3482 |
Cytogenetics | 12q23.3 |
Refseq ORF | 621 |
Synonyms | CBF-A; CBF-B; HAP3; NF-YB |
Summary | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401857 | NFYB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401857 | Transient overexpression lysate of nuclear transcription factor Y, beta (NFYB) |
CNY 3,080.00 |
|
PH302749 | NFYB MS Standard C13 and N15-labeled recombinant protein (NP_006157) |
CNY 19,520.00 |