PAIP1 (NM_182789) Human Recombinant Protein
CAT#: TP302735
Recombinant protein of human poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 2, 20 µg
View other "PAIP1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202735 protein sequence
Red=Cloning site Green=Tags(s) MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLSVNAPEFYPSGYSSSYTESYE DGCEDYPTLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGA RLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQ VTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCS RDVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLER EDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_877590 |
Locus ID | 10605 |
UniProt ID | Q9H074 |
Refseq Size | 2559 |
Cytogenetics | 5p12 |
Refseq ORF | 1200 |
Summary | The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405243 | PAIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405357 | PAIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405243 | Transient overexpression lysate of poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 3 |
CNY 3,080.00 |
|
LY405357 | Transient overexpression lysate of poly(A) binding protein interacting protein 1 (PAIP1), transcript variant 2 |
CNY 3,080.00 |
|
PH302735 | PAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_877590) |
CNY 19,520.00 |