VAMP4 (NM_003762) Human Recombinant Protein
CAT#: TP302734
Recombinant protein of human vesicle-associated membrane protein 4 (VAMP4), 20 µg
View other "VAMP4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202734 protein sequence
Red=Cloning site Green=Tags(s) MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003753 |
Locus ID | 8674 |
UniProt ID | O75379 |
Refseq Size | 5155 |
Cytogenetics | 1q24.3 |
Refseq ORF | 420 |
Synonyms | VAMP-4; VAMP24 |
Summary | Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418448 | VAMP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433976 | VAMP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418448 | Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4) |
CNY 3,080.00 |
|
LY433976 | Transient overexpression lysate of vesicle-associated membrane protein 4 (VAMP4), transcript variant 2 |
CNY 3,080.00 |
|
PH302734 | VAMP4 MS Standard C13 and N15-labeled recombinant protein (NP_003753) |
CNY 19,520.00 |