ARL 1 (ARL1) (NM_001177) Human Recombinant Protein
CAT#: TP302698
Recombinant protein of human ADP-ribosylation factor-like 1 (ARL1), 20 µg
View other "ARL 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202698 protein sequence
Red=Cloning site Green=Tags(s) MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGG QTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMA NSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001168 |
Locus ID | 400 |
UniProt ID | P40616 |
Refseq Size | 3253 |
Cytogenetics | 12q23.2 |
Refseq ORF | 543 |
Synonyms | ARFL1 |
Summary | The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420086 | ARL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420086 | Transient overexpression lysate of ADP-ribosylation factor-like 1 (ARL1) |
CNY 3,080.00 |
|
PH302698 | ARL1 MS Standard C13 and N15-labeled recombinant protein (NP_001168) |
CNY 19,520.00 |