C1orf41 (HSPB11) (NM_016126) Human Recombinant Protein
CAT#: TP302693
Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11), 20 µg
View other "C1orf41" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202693 protein sequence
Red=Cloning site Green=Tags(s) MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS NLSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057210 |
Locus ID | 51668 |
UniProt ID | Q9Y547 |
Refseq Size | 601 |
Cytogenetics | 1p32.3 |
Refseq ORF | 432 |
Synonyms | C1orf41; FAP232; HSPCO34; IFT25; PP25 |
Summary | Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414172 | HSPB11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414172 | Transient overexpression lysate of heat shock protein family B (small), member 11 (HSPB11) |
CNY 3,080.00 |
|
PH302693 | HSPB11 MS Standard C13 and N15-labeled recombinant protein (NP_057210) |
CNY 19,520.00 |
|
TP720224 | Recombinant protein of human heat shock protein family B (small), member 11 (HSPB11) |
CNY 3,140.00 |
其它C1orf41产品