SERPINB3 (NM_006919) Human Recombinant Protein
CAT#: TP302683
Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), 20 µg
View other "SERPINB3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202683 protein sequence
Red=Cloning site Green=Tags(s) MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.4 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008850 |
Locus ID | 6317 |
UniProt ID | P29508 |
Refseq Size | 1793 |
Cytogenetics | 18q21.33 |
Refseq ORF | 1170 |
Synonyms | HsT1196; SCC; SCCA-1; SCCA-PD; SCCA1; SSCA1; T4-A |
Summary | May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The kinetic profile and clinical implication of SCC-Ag in squamous cervical cancer patients undergoing radical hysterectomy using the Simoa assay: a prospective observational study
,Ye, S;Sun, X;Kang, B;Wu, F;Zheng, Z;Xiang, L;Lesénéchal, M;Heskia, F;Liang, J;Yang, H;,
BMC Cancer
,PubMed ID 32085736
[SERPINB3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416321 | SERPINB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416321 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3) |
CNY 3,080.00 |
|
PH302683 | SERPINB3 MS Standard C13 and N15-labeled recombinant protein (NP_008850) |
CNY 19,520.00 |
|
TP790063 | Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3), with N-terminal HIS tag, expressed in HEK293, 50ug |
CNY 3,900.00 |
其它SERPINB3产品