MED4 (NM_014166) Human Recombinant Protein
CAT#: TP302663
Recombinant protein of human mediator complex subunit 4 (MED4), 20 µg
View other "MED4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202663 protein sequence
Red=Cloning site Green=Tags(s) MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054885 |
Locus ID | 29079 |
UniProt ID | Q9NPJ6, A0A024RDY7 |
Refseq Size | 2287 |
Cytogenetics | 13q14.2 |
Refseq ORF | 810 |
Synonyms | ARC36; DRIP36; HSPC126; TRAP36; VDRIP |
Summary | This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415456 | MED4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415456 | Transient overexpression lysate of mediator complex subunit 4 (MED4) |
CNY 3,080.00 |
|
PH302663 | MED4 MS Standard C13 and N15-labeled recombinant protein (NP_054885) |
CNY 19,520.00 |