UFC1 (NM_016406) Human Recombinant Protein
CAT#: TP302661
Recombinant protein of human ubiquitin-fold modifier conjugating enzyme 1 (UFC1), 20 µg
View other "UFC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202661 representing NM_016406
Red=Cloning site Green=Tags(s) MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCW YIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMAL GLGPWLAVEIPDLIQKGVIQHKEKCNQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057490 |
Locus ID | 51506 |
UniProt ID | Q9Y3C8 |
Refseq Size | 1137 |
Cytogenetics | 1q23.3 |
Refseq ORF | 501 |
Synonyms | HSPC155; NEDSG |
Summary | UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1; MIM 610553) (Komatsu et al., 2004 [PubMed 15071506]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414002 | UFC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414002 | Transient overexpression lysate of ubiquitin-fold modifier conjugating enzyme 1 (UFC1) |
CNY 3,080.00 |
|
PH302661 | UFC1 MS Standard C13 and N15-labeled recombinant protein (NP_057490) |
CNY 19,520.00 |