SUSD4 (NM_001037175) Human Recombinant Protein
CAT#: TP302622
Recombinant protein of human sushi domain containing 4 (SUSD4), transcript variant 2, 20 µg
View other "SUSD4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202622 protein sequence
Red=Cloning site Green=Tags(s) MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTP SGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHG EKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRC FPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTC SSTSTTTSLF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032252 |
Locus ID | 55061 |
UniProt ID | Q5VX71 |
Refseq Size | 1114 |
Cytogenetics | 1q41 |
Refseq ORF | 870 |
Synonyms | PRO222 |
Summary | Acts as complement inhibitor by disrupting the formation of the classical C3 convertase. Isoform 3 inhibits the classical complement pathway, while membrane-bound isoform 1 inhibits deposition of C3b via both the classical and alternative complement pathways.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413412 | SUSD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421931 | SUSD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413412 | Transient overexpression lysate of sushi domain containing 4 (SUSD4), transcript variant 1 |
CNY 4,840.00 |
|
LY421931 | Transient overexpression lysate of sushi domain containing 4 (SUSD4), transcript variant 2 |
CNY 3,080.00 |
|
PH302622 | SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252) |
CNY 19,520.00 |