SUSD4 Rabbit Polyclonal Antibody
CAT#: TA342349
Rabbit Polyclonal Anti-SUSD4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 4,840.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the N terminal of human SUSD4. Synthetic peptide located within the following region: MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | sushi domain containing 4 |
Database Link | |
Background | SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown. |
Synonyms | PRO222 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Yeast: 92%; Rabbit: 85% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |