S100 calcium binding protein A14 (S100A14) (NM_020672) Human Recombinant Protein
CAT#: TP302590
Recombinant protein of human S100 calcium binding protein A14 (S100A14), 20 µg
View other "S100 calcium binding protein A14" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202590 protein sequence
Red=Cloning site Green=Tags(s) MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIAN LGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065723 |
Locus ID | 57402 |
UniProt ID | Q9HCY8 |
Refseq Size | 1075 |
Cytogenetics | 1q21.3 |
Refseq ORF | 312 |
Synonyms | BCMP84; S100A15 |
Summary | This gene encodes a member of the S100 protein family which contains an EF-hand motif and binds calcium. The gene is located in a cluster of S100 genes on chromosome 1. Levels of the encoded protein have been found to be lower in cancerous tissue and associated with metastasis suggesting a tumor suppressor function (PMID: 19956863, 19351828). [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402803 | S100A14 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402803 | Transient overexpression lysate of S100 calcium binding protein A14 (S100A14) |
CN¥ 3,080.00 |
|
PH302590 | S100A14 MS Standard C13 and N15-labeled recombinant protein (NP_065723) |
CN¥ 19,520.00 |
其它S100 calcium binding protein A14产品