URP2 (FERMT3) (NM_031471) Human Recombinant Protein
CAT#: TP302580
Recombinant protein of human fermitin family homolog 3 (Drosophila) (FERMT3), transcript variant URP2SF, 20 µg
View other "URP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202580 protein sequence
Red=Cloning site Green=Tags(s) MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKR QWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELS LLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLL QRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLL LEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIP ELKDHLRIFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKL LVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGP DASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMVRFKG SRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEY IGGYIFLSTRERARGEELDEDLFLQLTGGHEAF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 75.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_113659 |
Locus ID | 83706 |
UniProt ID | Q86UX7 |
Refseq Size | 2558 |
Cytogenetics | 11q13.1 |
Refseq ORF | 1989 |
Synonyms | KIND3; MIG-2; MIG2B; UNC112C; URP2; URP2SF |
Summary | Kindlins are a small family of proteins that mediate protein-protein interactions involved in integrin activation and thereby have a role in cell adhesion, migration, differentiation, and proliferation. The protein encoded by this gene has a key role in the regulation of hemostasis and thrombosis. This protein may also help maintain the membrane skeleton of erythrocytes. Mutations in this gene cause the autosomal recessive leukocyte adhesion deficiency syndrome-III (LAD-III). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2010] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
In Vivo Assessment of Protease Dynamics in Cutaneous Wound Healing by Degradomics Analysis of Porcine Wound Exudates *
,null,
Molecular & Cellular Proteomics : MCP
,PubMed ID 25516628
[FERMT3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403121 | FERMT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403121 | Transient overexpression lysate of fermitin family homolog 3 (Drosophila) (FERMT3), transcript variant URP2SF |
CN¥ 3,080.00 |
|
PH302580 | FERMT3 MS Standard C13 and N15-labeled recombinant protein (NP_113659) |
CN¥ 19,520.00 |