Rab4 (RAB4A) (NM_004578) Human Recombinant Protein
CAT#: TP302572
Recombinant protein of human RAB4A, member RAS oncogene family (RAB4A), 20 µg
View other "Rab4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202572 protein sequence
Red=Cloning site Green=Tags(s) MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTA GQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLE ASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQA PNAQECGC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004569 |
Locus ID | 5867 |
UniProt ID | P20338, A0A024R3U9 |
Refseq Size | 3056 |
Cytogenetics | 1q42.13 |
Refseq ORF | 654 |
Synonyms | HRES-1; HRES-1/RAB4; HRES1; RAB4 |
Summary | This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401450 | RAB4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401450 | Transient overexpression lysate of RAB4A, member RAS oncogene family (RAB4A) |
CNY 3,080.00 |
|
PH302572 | RAB4A MS Standard C13 and N15-labeled recombinant protein (NP_004569) |
CNY 19,520.00 |