Nck beta (NCK2) (NM_003581) Human Recombinant Protein
CAT#: TP302557
Recombinant protein of human NCK adaptor protein 2 (NCK2), transcript variant 1, 20 µg
View other "Nck beta" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202557 protein sequence
Red=Cloning site Green=Tags(s) MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF AGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH TMDELVEHYKKAPIFTSEHGEKLYLVRALQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003572 |
Locus ID | 8440 |
UniProt ID | O43639 |
Refseq Size | 2517 |
Cytogenetics | 2q12.2 |
Refseq ORF | 1140 |
Synonyms | GRB4; NCKbeta |
Summary | This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, ErbB signaling pathway, Pathogenic Escherichia coli infection, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401190 | NCK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423904 | NCK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401190 | Transient overexpression lysate of NCK adaptor protein 2 (NCK2), transcript variant 1 |
CNY 3,080.00 |
|
LY423904 | Transient overexpression lysate of NCK adaptor protein 2 (NCK2), transcript variant 2 |
CNY 3,080.00 |
|
PH300449 | NCK2 MS Standard C13 and N15-labeled recombinant protein (NP_001004720) |
CNY 19,520.00 |
|
PH302557 | NCK2 MS Standard C13 and N15-labeled recombinant protein (NP_003572) |
CNY 19,520.00 |
|
TP300449 | Recombinant protein of human NCK adaptor protein 2 (NCK2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Nck beta产品