C5orf19 (REEP2) (NM_016606) Human Recombinant Protein
CAT#: TP302507
Recombinant protein of human receptor accessory protein 2 (REEP2), 20 µg
View other "C5orf19" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202507 protein sequence
Red=Cloning site Green=Tags(s) MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057690 |
Locus ID | 51308 |
UniProt ID | Q9BRK0 |
Refseq Size | 2203 |
Cytogenetics | 5q31.2 |
Refseq ORF | 756 |
Synonyms | C5orf19; SGC32445; SPG72; Yip2d |
Summary | This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413861 | REEP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY413861 | Transient overexpression lysate of receptor accessory protein 2 (REEP2) |
CN¥ 3,080.00 |
|
PH302507 | REEP2 MS Standard C13 and N15-labeled recombinant protein (NP_057690) |
CN¥ 19,520.00 |
其它C5orf19产品