MMP1 (NM_002421) Human Recombinant Protein
CAT#: TP302460
Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, 20 µg
View other "MMP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202460 protein sequence
Red=Cloning site Green=Tags(s) MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002412 |
Locus ID | 4312 |
UniProt ID | P03956 |
Refseq Size | 2081 |
Cytogenetics | 11q22.2 |
Refseq ORF | 1407 |
Synonyms | CLG; CLGN |
Summary | This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Bladder cancer, Pathways in cancer, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419340 | MMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419340 | Transient overexpression lysate of matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
CNY 3,080.00 |
|
PH302460 | MMP1 MS Standard C13 and N15-labeled recombinant protein (NP_002412) |
CNY 19,520.00 |
|
TP720322 | Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
CNY 1,800.00 |
|
TP723882 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
CNY 5,240.00 |
|
TP760405 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP762607 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |