GMPR1 (GMPR) (NM_006877) Human Recombinant Protein
CAT#: TP302453
Recombinant protein of human guanosine monophosphate reductase (GMPR), 20 µg
View other "GMPR1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202453 protein sequence
Red=Cloning site Green=Tags(s) MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVE FVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAH GLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAG GVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006868 |
Locus ID | 2766 |
UniProt ID | P36959 |
Refseq Size | 1515 |
Cytogenetics | 6p22.3 |
Refseq ORF | 1035 |
Synonyms | GMPR 1; GMPR1 |
Summary | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416357 | GMPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416357 | Transient overexpression lysate of guanosine monophosphate reductase (GMPR) |
CNY 3,080.00 |
|
PH302453 | GMPR MS Standard C13 and N15-labeled recombinant protein (NP_006868) |
CNY 19,520.00 |