ABHD10 (NM_018394) Human Recombinant Protein
CAT#: TP302393
Recombinant protein of human abhydrolase domain containing 10 (ABHD10), 20 µg
View other "ABHD10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202393 protein sequence
Red=Cloning site Green=Tags(s) MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNRPDLPNLAYKK LKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDD LADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSMPSKYS EEGVYNVQYSFIKEAEHHCLLHSPIPVNCPIRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHR MREKADIQLLVYTIDDLIDKLSTIVN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060864 |
Locus ID | 55347 |
UniProt ID | Q9NUJ1 |
Refseq Size | 2771 |
Cytogenetics | 3q13.2 |
Refseq ORF | 918 |
Summary | This gene encodes a mitochondrially-localized enzyme that acts in liver cells as a hydrolase. The encoded protein removes glucuronide from mycophenolic acid acyl-glucuronide. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402682 | ABHD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402682 | Transient overexpression lysate of abhydrolase domain containing 10 (ABHD10) |
CNY 3,080.00 |
|
PH302393 | ABHD10 MS Standard C13 and N15-labeled recombinant protein (NP_060864) |
CNY 19,520.00 |